DPCstruct | MC19793
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 175 ± 34 aa |
| Standard deviation of domain lengths | 33.51 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 86.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 24.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06429 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V0NZY5 | 5-164 | FALALASEVNALHRTGYGLGGSTGLDFFDANTTGAADIALSQEVAEDEGKIAASADGSTGNGEIALAIFNLQNELAMEEGTTTLGGY… |
| A0A7Z6WIS0 | 8-188 | LAYTFATEFNKVHEEGLSPNEITDGDQAISFFADSESGSIGEREGFASRITISQDIKNSLDNIVNADPSNPTLGDATYVSKLADIFN… |
| A0A845LK42 | 46-215 | None |
| A0A7X8FUT3 | 118-256 | None |
| A0A521U0K1 | 370-578 | None |
| A0A7G6Z3C0 | 577-737 | None |
| A0A1G1E5K1 | 8-147 | None |
| A0A521SPW2 | 5-163 | None |
| A0A3S4KNZ5 | 7-176 | None |
| A0A2H0AFJ8 | 193-342 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.