DPCstruct | MC19790
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 144 ± 21 aa |
| Standard deviation of domain lengths | 21.28 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 37.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0248 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J5FWX5 | 25-180 | EHGRVSYVNTVKGDKVKTAFDVMEASDLILSNHLDGRINEAYPQELQPRDRTRLSSKLQVNTIAKSLQPEQLADSDLSSDGAPIIGN… |
| I9WQE5 | 1-114 | MNEREIYDLDYAIVKAKDLKPSFTTGGTQKRTDMNEEQIKSIAENFDPKKIFGSGGFEDLPIILHDGQVIAGNHRIQGMLNFTPKSR… |
| A5WEY6 | 45-220 | None |
| D7ICL6 | 322-450 | None |
| A0A2T6TPD9 | 341-471 | None |
| K2K277 | 1-123 | None |
| A0A0E0WA94 | 344-480 | None |
| A0A7Y3QBV1 | 21-182 | None |
| A0A293TS28 | 355-488 | None |
| A4WPN5 | 426-584 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.