DPCstruct | MC19788
Metacluster Properties and Pfam Annotations
| Number of structural domains | 167 |
|---|---|
| Mean domain length (aa) | 88 ± 9 aa |
| Standard deviation of domain lengths | 9.44 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.34 |
| Pfam Score | 98.84 |
| Assigned Pfam label(s) | PF00367- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A368YUU3 | 8-83 | QKIGKALVTLAALGGSKNLESVDACITRLRLEVVDNAVIDEKELRKLGASGIMKSGNSVQVVFGPGSDALKDKIKS |
| A0A0Q6G084 | 16-103 | GVGESEGVTSIAAAVEVLSAVGGAANVVRLTRCWSRLRFVLADPACADLEILGRLRTVAVVVFQGGELQVALSQGLVEVFEALRLQLT |
| A0A7X2T1U8 | 514-600 | None |
| W5SBI2 | 111-193 | None |
| D0R5W0 | 80-173 | None |
| A0A4R0XJT1 | 540-630 | None |
| K1MR81 | 162-248 | None |
| B9DLG6 | 1-88 | None |
| A0A449A4U2 | 611-689 | None |
| A0A381KJ58 | 437-523 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.