DPCstruct | MC19787
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 221 ± 11 aa |
| Standard deviation of domain lengths | 11.42 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 79.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 35.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A226N442 | 1-233 | MPFSFVDGQVDISRPFGPQPWHSCHKLIYVRPNPKTGVPIGHWPVPESFWPDQNSPTLPPRTSHPVVKFSCTDCEPMVIDKLPFDKY… |
| L7M6H7 | 175-383 | CRRLIYVQRSAQKGYSVGHWPLPEAFWPDLNSPSLPPRSAHPQVRVSGSPSEPLLLDNLPFDKYELEPSPLTQAILGRKQPTVAFAV… |
| A0A820GJN6 | 1-227 | None |
| A0A4X3P784 | 283-491 | None |
| A0A058Z4Y1 | 351-576 | None |
| A0A504ZAK5 | 211-430 | None |
| A0A819NDB7 | 2-230 | None |
| A0A0N4T293 | 93-299 | None |
| W6UCR0 | 201-421 | None |
| A0A2P4W156 | 221-434 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.