DPCstruct | MC19786
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 132 ± 11 aa |
| Standard deviation of domain lengths | 10.69 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 78.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 26.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13888 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3N1N7 | 121-231 | SFQIPISKFVPTNMRVTVQMNTTELLVVHLCHHDETFKCSALMDHDQTNEDDNFINTQGYVHEWPLPVSRFYSSSYHFRSAVAGQAD… |
| A0A226MWZ3 | 23-158 | IFVINAAVSPVADIVQYNAFRRSGNYSYIIPISKYTPINVEISLEINTTEPLIVFLCKVTLGNYCSYSPSSRNIGENIQASTQGRQH… |
| A0A5N5T221 | 35-163 | None |
| A0A224XKS6 | 153-299 | None |
| A0A2J7PM52 | 364-493 | None |
| A0A6P8UJL7 | 515-635 | None |
| A0A1Y1NJ86 | 3-132 | None |
| A0A672V657 | 702-835 | None |
| A0A3Q0IIV3 | 1-122 | None |
| A0A7J7RTL4 | 135-279 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.