DPCstruct | MC19785
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 404 ± 44 aa |
| Standard deviation of domain lengths | 43.65 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 18.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A226MGS6 | 61-423 | QVTKAIVECYSELSLSDKNKVISGVLEAWGGPGLSLNSQVVMEGFQEDLNVTFNQITKSVSDEGLTRAVAAVARLALLHPEATVKQI… |
| H9JE26 | 69-467 | SWLHALLYKDDLCAYRELLDVIHPNINKYSPQECLKLYYILKQGIVNKGQTEVLAVKAFHHCDVSDKHKILTEHFVNNCFFDMKENE… |
| A0A835NW65 | 766-1129 | None |
| A0A2N0RLG9 | 536-963 | None |
| A0A226NWH7 | 2-364 | None |
| Q22624 | 237-672 | None |
| A0A0N5D2C0 | 285-666 | None |
| A0A6J8ATF1 | 130-570 | None |
| A0A0B2VF97 | 186-710 | None |
| A0A397TLW3 | 1-397 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.