DPCstruct | MC19784
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 88 ± 10 aa |
| Standard deviation of domain lengths | 10.36 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 39.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R7VSK4 | 1-75 | MKKNNLECPMCITTVNIGKEPFIWPPCCKPGIFLHKICCQKLASNSGYSLKCPMCNNKDDFVNSLKKYGIFIPDQ |
| A0A084VH88 | 116-200 | VHVPLRADCNPHSAEEPCAICYEEMGPYDLITSIRAPCCKNSWFHQQCVARFAQTAGYFLKCPLCNNVDTFTQAIPLRGVYVPER |
| A0A3B4AIN1 | 101-192 | None |
| A0A7M4FPG8 | 133-215 | None |
| A0A0N0PEI3 | 174-256 | None |
| A0A3B5L402 | 103-190 | None |
| B7PQM8 | 37-117 | None |
| A0A6G0U4F8 | 156-234 | None |
| A0A147BNW1 | 30-114 | None |
| A0A3Q3AKH1 | 90-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.