DPCstruct | MC19783
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 99 ± 6 aa |
| Standard deviation of domain lengths | 6.19 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 57.85 |
| Pfam Score | 93.41 |
| Assigned Pfam label(s) | CL0023- PF16886 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V4JHA8 | 68-172 | WDFVPSKDIRVGSHITGGDIYGTVMENSLLQHRIMVPPRSRGTVTYVAPPGHYSVTDVVLELEFQGQAEQLTMLQVWPVRQTRPVAE… |
| A0A226MF35 | 1-100 | MVTPCQVGSHVTGGDIYGTVTENSLIQHKIMVPPRSRGTVTHIAPPGHYSVSDVVLELDFEGVAEQLTMMQVWPVRQTRPVVEKLVA… |
| Q5AUK9 | 60-160 | None |
| A0A0B0N577 | 136-233 | None |
| A0A7J8MKQ9 | 2-87 | None |
| A0A1R3I0G6 | 142-241 | None |
| A0A2A2K8K0 | 394-493 | None |
| A0A5N6PPI5 | 637-734 | None |
| A0A2G8LJ80 | 115-223 | None |
| W9YSL1 | 210-313 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.