DPCstruct | MC19782
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 57 ± 8 aa |
| Standard deviation of domain lengths | 7.64 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 60.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05907 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W3J4S4 | 73-124 | RWYLKLKCANCREASDKWQYISLMESVPLKGGRSSASMVQKCKLCSRENSID |
| A0A226M7N3 | 3-80 | RIGLQLRATLENITRLRAEGEDFRWYLKLKCGNCGEVSEKWQYLRLTDSAPLKGGRGSATMVQKCKLCSRENSIVKDE |
| A0A7C8YD65 | 108-165 | None |
| S9YAT6 | 145-198 | None |
| E3MHB3 | 368-423 | None |
| A0A553PDW9 | 268-319 | None |
| A0A158QYZ7 | 295-352 | None |
| A0A0N4U0J2 | 16-80 | None |
| A0A7J6DCT1 | 297-348 | None |
| A0A4D9ESL6 | 26-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.