DPCstruct | MC19779
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 74 ± 5 aa |
| Standard deviation of domain lengths | 5.21 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 27.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07205 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D5Q9Z8 | 25-98 | NSLLKEAIDELKNIHCGEVFLLKELFKGYEWNRLEMNIRLKLGKLFLYEVVTNPNLNVEVINKNSAYQQMYKKK |
| A0A069AN37 | 2-74 | NSLLKEAIDELKNIHCGEVFLLKELFKGYEWNRLEMNIRLKLGKLFLYEVVTNPNLNVEVINKNSAYQQMYKK |
| A0A839HL86 | 57-140 | None |
| A0A7X9M3U9 | 1-79 | None |
| A0A1W1UND6 | 272-344 | None |
| A0A4R3KV57 | 77-155 | None |
| A0A847KFB1 | 2-69 | None |
| A0A1E7W6A1 | 112-187 | None |
| Q2VHL1 | 41-114 | None |
| A0A1G6FH35 | 6-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.