DPCstruct | MC19778
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 142 ± 23 aa |
| Standard deviation of domain lengths | 22.98 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 56.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0E1U0 | 155-309 | RKPMVTPSLRASLTKQGYKIVGSHSGVKLCRWTKAMLRGRGGCYKHTFYGIVSYQCMEATPSLACANKCVFCWRHHDNPVGTSFRWQ… |
| A0A813LUU7 | 28-182 | AAMISEERRDKMEKQGWDVVGSHSATKLCRWTKSMLQGKGGCYKHTFYGIASHRCMEHTPNVSCANKCVFCWRNHINPVALDWKFDV… |
| A0A0C2ICF2 | 1-120 | None |
| A0A4D9BCS7 | 884-1007 | None |
| A0A061IZP3 | 9-131 | None |
| A0A0G4GG36 | 134-257 | None |
| A0A812IGZ7 | 270-423 | None |
| A0A7S0UK86 | 2-111 | None |
| A0A7J6LW53 | 219-343 | None |
| A0A7J4EXB5 | 2-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.