DPCstruct | MC19777
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 437 ± 82 aa |
| Standard deviation of domain lengths | 81.61 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 87.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 22.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20717 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812KUF9 | 252-670 | ASCPVESLAGLLVSVAGQHAEWDASRVGKQLQSLLPELHSQVGSYAVFEESAAREQAESACVSTVALLSNRYDIYTEQQLNGDKLTA… |
| A0A813LTL3 | 315-627 | DVARLPKFAAQLAPKAENPKQVLEHVLDNCPKVLPSFWRLPVAGRQLARECLTRDFSFAKFISAEVVPASITTIKDMLADSESTSDL… |
| A0A812PNW5 | 1-320 | None |
| A0A812LGS4 | 21-530 | None |
| A0A7S2N7H0 | 37-652 | None |
| A0A2K2VXF8 | 382-839 | None |
| A0A3N4S7K0 | 12-391 | None |
| A0A7S0A8X6 | 18-395 | None |
| A0A661J7T2 | 52-551 | None |
| A0A1Q9EPI2 | 5-390 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.