DPCstruct | MC19775
Metacluster Properties and Pfam Annotations
| Number of structural domains | 103 |
|---|---|
| Mean domain length (aa) | 127 ± 19 aa |
| Standard deviation of domain lengths | 19.28 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 20.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13827 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q9ELC2 | 8-115 | APQPRWLDRWGAVAIDAVASKMGTATDRKSSRDAERTALKDCKSRGGTEQQCKKTLLVYGNGCGAVAVGSDFIVARGGGSIEEASAR… |
| E1W2M8 | 16-142 | AFATTPSIEDQMSYPPPPPLLDFPNWWSVIAYNPQNGAFGYGEGGMIKAAQNKALKDCELASNDANKQHCQIVTEANHACVALATGD… |
| A0A7W9WW13 | 16-147 | None |
| A0A4Q7FUB1 | 25-129 | None |
| A0A3D2XD43 | 26-157 | None |
| A0A2V6EVV7 | 1-191 | None |
| A0A0S2FI15 | 104-182 | None |
| A0A2N9LSU3 | 44-172 | None |
| A0A840A9G1 | 29-196 | None |
| A0A378T6R0 | 1-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.