DPCstruct | MC19774
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 111 ± 11 aa |
| Standard deviation of domain lengths | 10.54 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A259S8C0 | 67-185 | YQVHTGRELSLMLEGKKPLSSFTEEYPLHGVSFIPESIFERYVTSGQFIKAEYISEHKSLEGDIYATHWVFYALRGEEWRINAYILL… |
| A0A2E2E654 | 13-133 | HEERELELMLAGVKPLAYFSELTRAEFEFPDAEFEPYVQAGRIIKRDILHIQKMFGQDEEIRSLYYALPGEEWRIDKAHANRLRGYL… |
| A0A845A0A0 | 5-103 | None |
| A0A1J4RNU5 | 3-121 | None |
| A0A534WJ20 | 3-104 | None |
| A0A7R6Y861 | 1-104 | None |
| A0A6M8W2E6 | 10-143 | None |
| A0A1Y6K6V5 | 99-214 | None |
| A0A4Q1TP14 | 2-117 | None |
| A0A7Z7FNH7 | 16-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.