DPCstruct | MC1977
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 77 ± 7 aa |
| Standard deviation of domain lengths | 7.08 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 32.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2M8VD60 | 6-90 | SDAPVVIAVAITGSVPRKKDNPAVPVTVAEQIQSTHQAFEAGATLCHIHVRNDDESPSSDPDKFAAVQEGLRRHCPGMIVQFSTG |
| A0A840J8D9 | 207-277 | VLTVAPTGPVASKTDNPDLPTQPEEIATAVQQAYEAGAAVAHIHLRDESDRPTANLSIARRTLDLIAERCP |
| A0A6G6FHV4 | 3-85 | None |
| A0A7R7BFL2 | 348-433 | None |
| M0AAA6 | 84-163 | None |
| S9QUH7 | 5-90 | None |
| A0A7W5HQZ5 | 3-69 | None |
| A0A2D0HNC0 | 1-64 | None |
| A0A7W6SWB1 | 1-66 | None |
| A0A6B1JW28 | 2-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.