DPCstruct | MC19767
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 110 ± 12 aa |
| Standard deviation of domain lengths | 12.13 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 40.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q1FIN5 | 138-246 | YYYANATYYTSTPGGYVVVEPPQGDVSEAPPASSENMENRLFIYPRKGQSQAQQDNDRYECHKWAVDQTNYDPTAAIPQGLSANQAM… |
| A0A7X3H6T6 | 3-102 | YFVAAGSYYLWNSTAQRYEVVAPPPTVQGNSVASYEVIAYPANGQSVDQQGRDRYECHGWAVGQSGFDPATATRPVGAEATERYRRA… |
| N2JDA1 | 146-244 | None |
| A0A521XYY8 | 3-135 | None |
| A0A1B8TJM4 | 256-356 | None |
| A0A0P9Z8V0 | 492-613 | None |
| A0A077F7F2 | 162-277 | None |
| A0A147GSD7 | 204-311 | None |
| A0A837ALT8 | 1-92 | None |
| A0A0C1NQF3 | 37-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.