DPCstruct | MC19765
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 77 ± 6 aa |
| Standard deviation of domain lengths | 5.51 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 33.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A454JLB8 | 3-77 | DEKDLIYSPLQQKYTADGKTVEVFIYRLPDSGWTLEIVDQYDNSTVYDGEFATDQEAFDLFLEEVASEGIEAMIG |
| A0A1J6Y1Y7 | 3-81 | DNDNTLDYDENDLIDSPLSQILQEDNEQIEVLIYRLPDSDWTLEVVNQNGTSTVWDETFPSDQEALSVALDGIKAVGGI |
| A0A0K6HZX8 | 184-264 | None |
| A0A2P8KHX4 | 14-87 | None |
| A0A7V7VSE7 | 35-105 | None |
| A0A1I1CMV9 | 1-84 | None |
| A0A4R2NYN2 | 420-498 | None |
| A0A432VQP0 | 3-78 | None |
| A0A6N0ZBF3 | 2-82 | None |
| A0A5C8TCV3 | 2-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.