DPCstruct | MC19763
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 108 ± 11 aa |
| Standard deviation of domain lengths | 10.71 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 74.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 37.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03626 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A126S9G7 | 2-93 | KSYMIGFVLSIILTAIPFGLVMFPSLPKNLTVLIVVAMAVIQVVVHLVYFLHMDRSKEQRSNVSTFLFTTLVIALLVGLSLWIMFSI… |
| A0A7W1KGN4 | 1-105 | MVKRIHGAGRGTTVSYLFGFILSLELTLAAYFLVVNRVLESRQLILTIMGLGVAQLLVQLVFFLHLGRESKPRWNLTVFSFMALVLV… |
| X5UDS1 | 14-132 | None |
| A0A7X3M0A6 | 45-139 | None |
| H6Q5G3 | 7-100 | None |
| A0A5M8P8N5 | 1-114 | None |
| A0A542B6Q4 | 9-119 | None |
| L0ET15 | 8-116 | None |
| J2L6L2 | 6-129 | None |
| A0A6B2PC56 | 2-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.