DPCstruct | MC19762
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 81 ± 14 aa |
| Standard deviation of domain lengths | 14.06 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 88.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832UQE3 | 63-127 | GAIPKDKLVVGKTYFGSCRNADTAIWLGDKFEYTRHKFGASYKEKINHFEDDDGYDLFVPIREIN |
| A0A7W1ILB0 | 3-73 | GPYIPVSVCQHGYLYRIIAHNFQFGVYIALEEGFVGVREKFGNTDLQIEYHYESGAPFGTALPFSRLERCP |
| A0A843FME2 | 18-95 | None |
| A0A431HGW1 | 2-83 | None |
| A0A2D6X930 | 114-184 | None |
| A0A7W1A002 | 13-87 | None |
| A0A1C2G4H3 | 16-115 | None |
| A0A5C7UKP5 | 4-76 | None |
| A0A3A4VMZ8 | 3-82 | None |
| A0A523VY54 | 2-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.