DPCstruct | MC19761
Metacluster Properties and Pfam Annotations
| Number of structural domains | 221 |
|---|---|
| Mean domain length (aa) | 169 ± 22 aa |
| Standard deviation of domain lengths | 22.15 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 20.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0037 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090BV68 | 2-191 | NLLTQSYQYPVNGAAGMVGNLWVESGVLPNRIEGSQMATPLRSKNFQGQWVDFTAEQVMNRHPQTRQGPRYPGVGLAQWTSAKRRRS… |
| A0A7W1IKS5 | 5-155 | SDNAEKIYKFLVGKGLTPFQAAGIMGNIKAESGFNPGIVEGGSGIGYGIIQWSFGRRTKLEAAAAAKGVPVSDLAFQLDYLWEELNQ… |
| A0A659S6S1 | 36-216 | None |
| K8Z856 | 76-237 | None |
| A0A7X8K7H0 | 414-566 | None |
| A0A843D548 | 11-156 | None |
| A0A401FPP6 | 487-654 | None |
| A0A2P8EMC4 | 224-392 | None |
| A0A1N7FKD2 | 496-698 | None |
| R6GSJ3 | 558-699 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.