DPCstruct | MC19756
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 88 ± 3 aa |
| Standard deviation of domain lengths | 3.49 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 88.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 45.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G0FK53 | 608-694 | INIEKIMNEGKILFLNLSIGEIGEDNSALLGAMMITKIQLAAMRRTTIPEDDRRDFYLYVDEFQNFATESFATILSEARKYHLNLIM |
| A0A136LZM2 | 382-472 | MNSGKVLLVNLSQGKIGEENSSLLGGMLVTRLYTNAMQRARMAESERRDFYVYVDEFQNFATDSFAKILSEARKYALNLVVTHQYVD… |
| A0A2J6NDU0 | 36-121 | None |
| A0A0P7I3T9 | 80-169 | None |
| A0A662T4N6 | 250-336 | None |
| A0A0G2BFB8 | 56-145 | None |
| A0A831XPZ3 | 18-110 | None |
| A0A0G0CIW9 | 225-311 | None |
| A0A7W6SZ35 | 82-169 | None |
| A0A6G0A0B8 | 231-317 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.