DPCstruct | MC19753
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 158 ± 11 aa |
| Standard deviation of domain lengths | 11.33 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.13 |
| Pfam Score | 95.00 |
| Assigned Pfam label(s) | CL0063- PF07541- CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C1KX75 | 2-152 | AEIGKTVDDAYKDVGFILEERYGEVYTGLEEIIIEGKSALEGVPEEWIEPVVKVAGENIVLPTVEIEGFVELQIKSGDGVLKIKEAL… |
| A0A640W671 | 7-156 | REAGINEEECNKIGEQLFEKFGNLYTAFEEVLKDEKILEKEGFEGKWMEKFIEIAKENIPPPIVEIAGYVEMTCFKSDGIKYIKEAL… |
| A0A094I2U0 | 174-329 | None |
| A0A843DK39 | 31-186 | None |
| M4DKI8 | 202-375 | None |
| A0A7J7IIY3 | 112-257 | None |
| A0A834T7I0 | 113-284 | None |
| A0A194QQ74 | 742-891 | None |
| A0A0G4KCG2 | 115-272 | None |
| A0A2E3BZL0 | 123-282 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.