DPCstruct | MC19752
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 125 ± 17 aa |
| Standard deviation of domain lengths | 16.84 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 27.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R7ANM1 | 1-106 | MDTDQLLRLEEEAARWGFSQRLPADWLREHAQVAASHYLFPVMEHWLSHRPEVSPQWRCELLLTVRTGEEVSSLLDVRPASFQELAE… |
| A0A1V2PDH2 | 1-136 | MGLFGRRRHPQWPRIDMYTPGSPSDIKRLTLDDLDRLMTKAESAEFSAVGRPAWLEQHRSRIRQQYLIVFGPEGDGAYRCYAAALLD… |
| A0A7C9NKE6 | 4-134 | None |
| A0A0M8YG10 | 1-118 | None |
| A0A238Y643 | 4-108 | None |
| A0A318KCT5 | 54-198 | None |
| A0A2N0FIU9 | 1-151 | None |
| A0A4Q7WZ98 | 2-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.