DPCstruct | MC19750
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 104 ± 5 aa |
| Standard deviation of domain lengths | 4.83 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 90.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 32.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A254R0K0 | 60-168 | FPARLNDVLAEWVAGGLSEQAFLERAEWTKVWNFDPELYLPIFRLCRDNAIEMVGLNCSRGLVSEVGKLDWDEIPEADREGLTPALP… |
| A0A7C2TGH7 | 348-449 | PRSTQPVLDAYLAGELEEPQFLKESSWFNNWQFDYRLYREIIDFARHHQLPIIALNLEKGITNKVFREGGVSALSPEEQAELPPERD… |
| A0A843S2U5 | 112-214 | None |
| A0A1F5C174 | 115-214 | None |
| A0A6S6M028 | 1-111 | None |
| A0A2N2TZ80 | 124-217 | None |
| A0A3C1BQH1 | 40-145 | None |
| A0A1G3AQZ4 | 412-517 | None |
| A0A3M1Y9K9 | 563-663 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.