DPCstruct | MC1975
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 91 ± 6 aa |
| Standard deviation of domain lengths | 6.37 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 33.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06097 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E6U7E8 | 289-376 | ALLDLNIQVSKPMLVDLLSVQAQLDGQTDAKAIVDQSKEAADMFAGMAVGSQLAVVDGSNVVTKLHYAANQVEFNGQKMTVEQFVGFL |
| A0A2M8V8U8 | 2-95 | QEIAVQAIKKIDASLVISKPMVQDLMVQYAMKKEGLTAEKAAADADESIRQMAGMAEMMNVGKNDGDNIVGKFTFADGMGDLNGQKI… |
| A0A376KVG6 | 6-94 | None |
| A0A1W9F1Y1 | 53-153 | None |
| A0A0N8RTA4 | 57-143 | None |
| A0A3S4K9L1 | 143-233 | None |
| A0A6V7KFU6 | 160-266 | None |
| A0A6I2J4U4 | 12-100 | None |
| A0A378EI21 | 45-131 | None |
| A0A3Q9KDQ8 | 317-405 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.