DPCstruct | MC19746
Metacluster Properties and Pfam Annotations
| Number of structural domains | 184 |
|---|---|
| Mean domain length (aa) | 87 ± 15 aa |
| Standard deviation of domain lengths | 14.78 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 23.25 |
| Pfam Score | 98.94 |
| Assigned Pfam label(s) | CL0010- CL0644- CL0730- CL0173 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H9H490 | 2-64 | GADTPTSCCFSYISRHIPQNFVADYFETSSQCSKPGVIFLTKRGRQVCADPSEDWVQKYVSDL |
| A0A3Q3M453 | 2-87 | LLVILLLKRVIFFFKEPMKSCCTQYHESPIPFKALQHYTVQDEKQNCNIKAIIFTTKKNRLVCANPDREWVQYAIGERNIRESKGP |
| A0A218VD49 | 237-318 | None |
| E1BSX8 | 148-231 | None |
| A0A3Q4MWP1 | 6-78 | None |
| A0A6J2REX0 | 6-103 | None |
| A0A6J3GG38 | 100-173 | None |
| A0A7J7FGE6 | 1-72 | None |
| A0A498NGC2 | 9-100 | None |
| O35903 | 1-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.