DPCstruct | MC19743
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 140 ± 16 aa |
| Standard deviation of domain lengths | 16.36 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 26.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C1LK75 | 51-183 | TFLFLLFFASNMSAVLNNSKIGSSKEIINYENNLKDLKNSGYWTLPNITIDDLAWNNWAWAATQPWCSGTGDSGDPYIIENVNIKSS… |
| A0A0F9JPE4 | 7-152 | AKIIILITLGILIALTPLITVNQGLITDTKDAINLDTKNLKISAVSGKIHIKSKSLLDDWTDAKNAGIVTGNGTYSEPYIIEDLVID… |
| A0A0F9SBM0 | 8-153 | None |
| A0A497N6Z8 | 4-142 | None |
| A0A410FVI1 | 2-108 | None |
| A0A0F9NDH1 | 2-148 | None |
| A0A7C1C231 | 366-475 | None |
| A0A1Q9NMM0 | 1-162 | None |
| A0A1Q9NKJ0 | 1-167 | None |
| A0A7J2NHF6 | 29-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.