DPCstruct | MC1974
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 136 ± 10 aa |
| Standard deviation of domain lengths | 9.70 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 95.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 39.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0317 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377E8G0 | 94-226 | ARLIQTDGEDGYFHGKWARGGPEIVNNLGCADCHNTASPEFAKGKPELTLSRPYAARAMEAIGKPFEKAGRFDQQSMVCGQCHVEYY… |
| A0A2M8V750 | 1-139 | MSTYYQKDGHTDWNHTQTGGLNKAELHQGVSCGDCHSNKDMSLTITRPAFVNAMAKRGVDVKEATHQQMRTYVCAQCHVEYYFEKDS… |
| A0A069ZKM8 | 2-138 | None |
| A0A7C1H7T3 | 150-280 | None |
| A0A7G6DYK6 | 22-141 | None |
| A0A378MW62 | 139-267 | None |
| A0A0X8X7K5 | 1-140 | None |
| A0A376NYE6 | 133-278 | None |
| F4N7R0 | 104-249 | None |
| S0G5H6 | 2-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.