DPCstruct | MC19733
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 343 ± 40 aa |
| Standard deviation of domain lengths | 40.49 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 32.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812J5V2 | 187-490 | EGKTPKENIYLRKFKDGLDDVIESCGEGKWMLQEKHADDFQSPGKGVFQFAGPIVGCRVTSVSFTGLPCQQPGNITEEEVDVQPMVL… |
| A0A812Q9U7 | 17-362 | TNASDFKKGSMEAPEYYGNAVACTGRDVVANALENGYEEFELEFLPAELNDTAVLQKPKALQPAVLKPFVRSCSLTASSTAVFGTLE… |
| A0A1Q9DFG7 | 85-404 | None |
| A0A812GCH8 | 4-320 | None |
| A0A812HSS3 | 727-1073 | None |
| A0A812HS47 | 109-424 | None |
| A0A812W3I4 | 286-594 | None |
| A0A813CJF1 | 550-947 | None |
| A0A812TYA6 | 216-581 | None |
| A0A812MSY4 | 63-394 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.