DPCstruct | MC19732
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 101 ± 3 aa |
| Standard deviation of domain lengths | 3.20 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 85.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 53.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4HQQ3 | 206-303 | ALEAALFAIVYRYCVREDTNPMLNQGVVGAFVLVRTLSRVSVPTYCTTVPLDCGAPLGYFDWNMLTQAGLNGLESAALFGAAAAAME… |
| A0A812Q398 | 1-104 | MLALDVFLFGLVYRYAVRTGDDNPMLRLGVLGAFALPRALFLVRMPAECQALPLSCGPPLGYFNWDMLAQVAWHFFSGTLVFAVALY… |
| B8CAB6 | 98-200 | None |
| A0A1E7EY09 | 128-229 | None |
| A0A7S2HB25 | 245-345 | None |
| A0A7S2X6P8 | 103-204 | None |
| A0A1Z5KM82 | 116-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.