DPCstruct | MC19731
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 446 ± 66 aa |
| Standard deviation of domain lengths | 65.70 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 22.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812PUU5 | 76-512 | NHIMQDLIINAAIVLAAVTGPGNPADFSRRLGAAVHRFLVVLYAVSALHKLNSDWFDAQVSCASSVTATLLAQYGPAWLKGSPVATF… |
| A0A813EHH0 | 12-431 | ALLEIVFVLAVLGGGGSKVIADRFLKAARVLLIILYFSAAFWKLTTSWYDTYTSCAPVLLSELLSGLAPASVLPGGSMPANFLLKIS… |
| R1ETB1 | 260-694 | None |
| A0A812MGW1 | 11-369 | None |
| R1E7Y8 | 37-511 | None |
| A0A7S1JVA4 | 6-395 | None |
| A0A813DAD9 | 69-583 | None |
| A0A7V9BVG6 | 59-418 | None |
| A0A0Q7Z9X5 | 3-384 | None |
| A0A7S3JX21 | 2-392 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.