DPCstruct | MC19730
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 275 ± 32 aa |
| Standard deviation of domain lengths | 31.50 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 70.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.23 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 16.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812PSY6 | 56-295 | KNKVRRICTPKPGSGNLEVPENIFEMFQDAATGRETLYKMWAKSGGVKAVFLESVTIMCQTNRSKKLTVKGGFYSKEDMRAELGYSA… |
| A0A813BTY5 | 276-550 | MRLKRLCERKKTGKAWVSDELITDYKSGGSSREQLEIALLETIKQLGPDAAHQKMRAAFTSRVTLVKERILQREKEVTGEWLTEERM… |
| A0A812YZ03 | 209-473 | None |
| A0A812Q807 | 2-289 | None |
| A0A812R1D4 | 12-295 | None |
| A0A1Q9E7X4 | 1-270 | None |
| A0A812YSM1 | 3-269 | None |
| A0A813BIY3 | 11-238 | None |
| A0A812HKP3 | 69-328 | None |
| A0A812MGD4 | 2-294 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.