DPCstruct | MC1973
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 63 ± 8 aa |
| Standard deviation of domain lengths | 7.88 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 45.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2M8V3Z4 | 5-65 | ETSAVEYRLTAMDRCDSCGAQAYIAAEVNGSELLFCAHHGRKYEEKLRSVATSWHDETARL |
| A0A7W3IUI8 | 1-54 | MNAADRCDRCGAQAYMRVTLSGGGELLFCAHHGKEHADRLKQVALKIQDETDRL |
| A0A6N7H9K3 | 10-69 | None |
| A0A6J4L5C8 | 19-82 | None |
| U2QS74 | 55-119 | None |
| A0A2W1TPT5 | 10-72 | None |
| A0A060ZJQ6 | 1-55 | None |
| A0A6J7QU16 | 73-138 | None |
| A0A562IE99 | 6-66 | None |
| A0A543G9B5 | 6-59 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.