DPCstruct | MC19728
Metacluster Properties and Pfam Annotations
| Number of structural domains | 117 |
|---|---|
| Mean domain length (aa) | 387 ± 81 aa |
| Standard deviation of domain lengths | 80.92 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 80.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 19.86 |
| Pfam Score | 71.43 |
| Assigned Pfam label(s) | PF02181- CL0173 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812QBK8 | 159-545 | RERSDSRLARHMSRRYSAVDQEIVRAISLARTLQGCGSIWRYNPARLSPEDRMAIFNQSVPVDSFDVFLSHTWFTKGRWKVLTLMLQ… |
| A0A812P5Y3 | 90-482 | GQLYLSSTRNLTYVAFVVFFYFWQPMRSMARRPLVVFLDKLCLAHHDADLKQQGILGLAAFSDRSEHLTILWSARYFRRLWCCYELA… |
| A0A1Q9C5D3 | 749-1244 | None |
| A0A813BTY8 | 10-239 | None |
| A0A7S4SJ00 | 9-276 | None |
| A0A1Q9BZH6 | 68-501 | None |
| A0A1Q9CC44 | 397-860 | None |
| A0A812QCB0 | 4-340 | None |
| A0A812IVP3 | 76-390 | None |
| A0A812KD77 | 46-293 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.