DPCstruct | MC19727
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 181 ± 37 aa |
| Standard deviation of domain lengths | 37.03 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 71.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812LFQ4 | 90-282 | VKESKHERKKRLHARNMRFYRSLSSPNCPKEIAKLALKAKENSGQRSYLFEHWLLANGCWAKSRLLVKLRSKSSSRKKGLRRWYTKQ… |
| A0A812P570 | 3-164 | SILFEAWEKCQGNWKTSSIYLNLKSISRSRRTGVRVWMTRAEVIAKFGEVSADAIILRKQGDEKLRATEIRRHPELPESDDLVQYLI… |
| A0A813AIJ3 | 31-209 | None |
| A0A1Q8ZK62 | 19-277 | None |
| A0A1Q9BYK0 | 53-241 | None |
| A0A812IVQ8 | 14-210 | None |
| A0A812KR15 | 36-209 | None |
| A0A812SJT4 | 36-351 | None |
| A0A812MXI5 | 7-141 | None |
| A0A812SFS2 | 281-470 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.