DPCstruct | MC19724
Metacluster Properties and Pfam Annotations
| Number of structural domains | 299 |
|---|---|
| Mean domain length (aa) | 119 ± 23 aa |
| Standard deviation of domain lengths | 22.89 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 80.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 18.78 |
| Pfam Score | 97.75 |
| Assigned Pfam label(s) | CL0023- CL0036- PF07683 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832N0K5 | 1-79 | DPAAFTAKIADVIRTHNILRLKGFAAVAGKPMRLTIQAVGPRVDSYFDRPFATGENRGTTLVVIGQAGLDQAAITKALG |
| A0A812NG90 | 4-131 | YGVASLVFRAQKPFHPKRLDELLKRGLETEILRSKGRLWVAGLDDVSFIWHQAGSTLSIDVGPGWLHGSLDPKDWPADTPQEYRTQP… |
| K8ED79 | 415-530 | None |
| A0A7S2SM22 | 99-206 | None |
| R5UZW3 | 3-132 | None |
| A0A484VHQ8 | 64-210 | None |
| A0A397FGK8 | 226-353 | None |
| A0A1B8EP07 | 264-385 | None |
| A0A7S2L6U8 | 372-475 | None |
| V5DE52 | 442-564 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.