DPCstruct | MC19723
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 417 ± 38 aa |
| Standard deviation of domain lengths | 37.70 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 67.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.26 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 17.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813D4R6 | 3-360 | ISRVKNEAKPQEVMRVMRACYKSLDLHTFIMADFGLVIQNHIVFLRQCLLVTRRPNEWLLEQAGLLAFPENPSTVKLFASQLCKAAQ… |
| A0A812MYI7 | 3-420 | MSSRRSNGATGKDLMKTFRGNLQAVEAGDALLSLDAFCKKHHVLMKEILGITTRPTAAVMRESMSLVWPGAPSLELKTFANHLHEVY… |
| A0A1Q9DDM8 | 1-487 | None |
| A0A812KXI4 | 2-386 | None |
| A0A812JSJ4 | 7-431 | None |
| A0A1Q9CRD4 | 1-439 | None |
| A0A1Q9DEX2 | 21-392 | None |
| A0A813HHM9 | 2-434 | None |
| A0A812RNS5 | 1-406 | None |
| A0A812R0M1 | 137-543 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.