DPCstruct | MC19721
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 143 ± 17 aa |
| Standard deviation of domain lengths | 16.92 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A383WN82 | 2-118 | LQQYGPGAFLCYITCSNLLSVGMLSSAWLLFTRTTGFTPLQAGQWPKFLVFYAGAYAMTHAARPLKLAVGLACAPVGTALVDGVAWT… |
| A0A7S0SG09 | 6-152 | TARFKAWWAKASKIDRSTVAALGGAALLSYGFVSNVFYISSLLLATYSTVNTLGVSPLASKAAMQSFGATYFGLWVIQNFLRPARMA… |
| A0A7S0XEB0 | 345-496 | None |
| A0A7S0N3G0 | 90-268 | None |
| A0A812JMK0 | 82-227 | None |
| A0A7S2HMC2 | 1-131 | None |
| A0A813A9R6 | 27-188 | None |
| A0A1Q9E0E2 | 57-194 | None |
| A0A7S0H3V2 | 21-169 | None |
| A0A7S0H724 | 165-306 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.