DPCstruct | MC1972
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 87 ± 11 aa |
| Standard deviation of domain lengths | 11.42 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 23.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A419SYD2 | 14-103 | KAENIGKQRGFLYNGHKYRVIKDFIDYDGTTHNKGEVWTFLAYSFNYYDNGLQWFITFDGDEEWSIPLFLDDMEQQDIDSHPEVYIE… |
| A0A2H9U4K3 | 107-179 | LESSAEYNITRDFSDLDGRNLKNGTTFSLLAKDLFAKEEGYTLKTSIGTIRLHGQINRLIIENLDLYIDEAGS |
| A0A4Q6XIQ6 | 12-99 | None |
| A0A4V6WQ65 | 4-74 | None |
| A0A1I1C924 | 14-130 | None |
| Q02BL7 | 71-151 | None |
| A0A350UIB6 | 89-179 | None |
| F5RJG9 | 47-146 | None |
| A0A2C6CHJ7 | 66-158 | None |
| A0A1T4XI28 | 4-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.