DPCstruct | MC19717
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 213 ± 23 aa |
| Standard deviation of domain lengths | 22.62 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 64.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812JMY3 | 73-300 | KWEAAMATWRCQIRYLHKLFTTTEKVDTVLEVTHRRTLPEEETLQDYFAAVLCSLFELSMYSVYLTSCPAKLACLVVEGSEFRYEDE… |
| A0A812KY70 | 2-211 | PADVKCSAAAQVLDLSFRRSQTEENVLYECFSMVLASAHELLEYALYLRRAPACAAALIVPGDGNTSAKQSVLSEMKQEWETVLFME… |
| A0A812HV26 | 1-243 | None |
| A0A812YFI3 | 726-943 | None |
| A0A812RHA2 | 496-672 | None |
| A0A812NAS0 | 22-223 | None |
| A0A812N194 | 2-185 | None |
| A0A1Q9BWT1 | 26-264 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.