DPCstruct | MC19713
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 88 ± 6 aa |
| Standard deviation of domain lengths | 5.85 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 47.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0182 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090S855 | 66-161 | PILVPMLMAVGISPELSQAAYRVGDSVSNIISPLMVFFPLVVVYCQRYVKSTGIGTLASLMMPFSIAMLIGWTIFLLAYWALGIPLG… |
| A0A6F7W371 | 14-97 | AVAHPPEATQAVYRIADSCTNAITPMSAYFVMALGFLQRYRRSAGIGTLASLTLPLSVAMLVAWTLLFYAWWAPGIPLGPGAPV |
| A0A091C3K9 | 44-131 | None |
| A0A3D1BPA8 | 9-83 | None |
| A0A165VBX4 | 3-91 | None |
| A0A2X1J0F9 | 48-141 | None |
| A0A3S5D894 | 2-88 | None |
| H1D3H8 | 98-185 | None |
| A0A846E2F5 | 172-259 | None |
| A0A645DRN0 | 8-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.