DPCstruct | MC19711
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 81 ± 8 aa |
| Standard deviation of domain lengths | 8.37 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S1ALN7 | 5-72 | EEFLYQIATPGNGQLITKGELEQKYVISGYEERECVRDELYGQPKLVGFSGPMWNGRKNGIPVIRYES |
| A0A4U0YT79 | 1-82 | MTYKLVFMADGAPTAVATDDLAFACANLGLTITGVERRATLRPCLQGQPKIAGMIGPCYGGEDDGVPVIRYEDAATHAALGA |
| A0A5C5ZJZ9 | 3-77 | None |
| A0A5B9MGA2 | 1-79 | None |
| A0A518VCK1 | 137-204 | None |
| A0A5B9PH49 | 33-119 | None |
| A0A2S4EIW2 | 113-200 | None |
| A0A0D1KDW3 | 8-91 | None |
| A0A848H936 | 1-79 | None |
| A0A7W6LW17 | 1-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.