DPCstruct | MC19704
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 202 ± 12 aa |
| Standard deviation of domain lengths | 12.32 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03692 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0LLC1 | 178-378 | ACVQCGTCCRKGSPSLQLEDLELLQTGRIPWNQLVTLRRGEPVQSPFDRKPFFLLDERIKIRERADSQECVFFNADTCLCAIYADRP… |
| A0A101FQ73 | 139-347 | AGRNACIRCGTCCRKGGPTLHREDISILLDGHAGHRHLVTIRKGEPVFDPVRGTLRPAQQELVKVRGKGKDWTCCFFDEQTSSCTIY… |
| S7USR2 | 3-175 | None |
| A0A1F9MK52 | 5-206 | None |
| A0A7V8DKB5 | 37-247 | None |
| G1UT99 | 2-217 | None |
| A0A7Y2ZZQ7 | 7-221 | None |
| A0A1I4TSL0 | 87-281 | None |
| A0A432UG70 | 34-232 | None |
| A0A522V3D8 | 30-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.