DPCstruct | MC19701
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 68 ± 7 aa |
| Standard deviation of domain lengths | 7.36 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 36.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X1CYA1 | 4-65 | ELVRVRGIGPTAAERLVNAGVKTIEEIAKSKPEQLAWIKGIGMLSANKIIENALELLKQLLQ |
| A0A7K4H9N0 | 1-63 | MSNELERVSGIGPIAAINLNKAGVKTIEEIAEAKPEDLAWIKGIGIISAKKIIENANNLLKLE |
| A0A2E8J2R2 | 1-86 | None |
| A0A1N7EL78 | 230-295 | None |
| A0A3N5LW28 | 43-123 | None |
| A0A7V3RYX4 | 68-140 | None |
| X1HG01 | 16-80 | None |
| A0A524DUW6 | 1-67 | None |
| A0A532TGG4 | 35-99 | None |
| A0A2H5VUR7 | 187-251 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.