DPCstruct | MC197
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 71 ± 5 aa |
| Standard deviation of domain lengths | 5.17 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09493 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8A9ECP1 | 3-64 | INSKWTAVTPLNREKHFLITELDFDEDEEVIHCLIEAIISKRSEPIEWQELKNDEKWLQGWK |
| A0A5Q0S5X8 | 3-71 | KFNPRKLRLSKWTACNPVNREKHFLVLQLLCDEHGSPIQVELQAVRSARIEWLDWQVLRDSTRWKMGWS |
| A0A7I4ANK2 | 110-170 | None |
| A0A2E2VVY5 | 29-94 | None |
| A0A0S2SQ82 | 165-238 | None |
| A0A0W7U294 | 33-105 | None |
| C1FFS2 | 140-212 | None |
| A0A7S2X1Q9 | 419-490 | None |
| A0A2D9P325 | 1-64 | None |
| A0A830HXZ0 | 91-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.