DPCstruct | MC19697
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 355 ± 37 aa |
| Standard deviation of domain lengths | 36.52 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 20.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M7H1M1 | 98-464 | GNPLFLDSLTVVSPEMAPVSPQLGLKLVLSSINQAGPEGVLVSNPKVVPGKKAGDTVFYSIHVNKILYDKAILAATKINSGEILPDN… |
| A0A1M5NKY4 | 11-347 | GQKLDPSNGIVLTDTAQASSNTDILQTPKYQSGVPKQTTVYYSIFMDKLLYDTMIKYGPIAKNDPTKVKDITFPVGALELKTSWIDA… |
| A0A554VFC2 | 368-730 | None |
| A0A2V9ACU6 | 259-601 | None |
| A0A7Y8RAA6 | 6-346 | None |
| A0A537TMC0 | 7-294 | None |
| A0A483AC05 | 182-514 | None |
| A0A4Q1FSE0 | 49-466 | None |
| A0A1Q2M4E6 | 30-399 | None |
| A0A150QX81 | 27-389 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.