DPCstruct | MC19692
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 546 ± 46 aa |
| Standard deviation of domain lengths | 45.73 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0W1QKC5 | 2-504 | VKLVIWDLDDTLWRGTLAEGETVTPFASRFDLVRRLNDHGVVSAICSKNDPQAAESQLRAFGLWDAFVFPRIAFVPKGPAVAAIIDD… |
| A0A1H9TUK4 | 706-1279 | EFFDYEKIKMIIWDMDETFWQGILSEGEVILPISNADLVRNITDHGVVNSISSKNDEIPVMDELERAGIADLFVFNNINWQDKGHQI… |
| A0A853FUM1 | 142-672 | None |
| A0A5B9GIW0 | 3-477 | None |
| A0A7W6QS33 | 224-723 | None |
| A0A4P7WCS4 | 3-576 | None |
| A0A2D3HGF3 | 3-576 | None |
| F0Y419 | 202-816 | None |
| A0A2J8GXS0 | 4-534 | None |
| A0A7I7L087 | 2-601 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.