DPCstruct | MC19686
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 128 ± 12 aa |
| Standard deviation of domain lengths | 11.62 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 33.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0090 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C5G1H5 | 10-134 | EPQFKHYDRDLIRDDLEQRVTFARDFLRFTEDDGKLLNSVAPLISPLIKPTVDGVYTQLFRFDVTSRPFLKKNADYEGNEHAVDLSQ… |
| A0A1Y1YWY3 | 1-120 | MNHVDRALLHTYPVYCYNYVAKFVGFSNKDVQAIKSVSERLAPLSGVVVDTVYDKLRAFDITWESMAKQHKGYAGKVVEKVQDLKVD… |
| A0A0L0SPI9 | 29-166 | None |
| A0A395HJD6 | 1-129 | None |
| A0A1Y2EMZ4 | 48-172 | None |
| A0A5N6G159 | 1-130 | None |
| A0A817CWY4 | 1-109 | None |
| A0A2I1D342 | 1-128 | None |
| A0A820HEF6 | 1-114 | None |
| A0A093URS6 | 1-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.