DPCstruct | MC1968
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 283 ± 25 aa |
| Standard deviation of domain lengths | 25.06 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 12.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A316FI35 | 1-298 | MSFTFAINDVNSLSFKRLIEVLGINDLQFVDSHKKPENDLWPDGFTYVFRNKQSARPLEVDYENKRVGVRVFTGSSVEDHQLAIDLT… |
| A0A7X7H4L8 | 1-292 | MTLTVTLRSDNQKTLTFEALETLCRGQYWIGTQSINGVFLEINAYDEAQFGVMILDPTELSRGIYLMLEEELSAVTLIMPTPSATND… |
| A0A2E7MAY3 | 1-308 | None |
| A0A1H9PKI2 | 1-328 | None |
| A0A3D3JRL8 | 1-261 | None |
| A0A291GAL2 | 1-290 | None |
| A0A833JCJ1 | 1-262 | None |
| A0A1M6SED6 | 1-273 | None |
| G1W8C9 | 1-301 | None |
| A0A1C5TUE7 | 1-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.