DPCstruct | MC19677
Metacluster Properties and Pfam Annotations
| Number of structural domains | 74 |
|---|---|
| Mean domain length (aa) | 118 ± 19 aa |
| Standard deviation of domain lengths | 19.17 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 88.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 37.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02898 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U3YZI5 | 120-227 | MNPKSLTRGPRDKPTPPDELLPQAIEFVNHYYSSFKEAKIEEHLARVEAVTKEIETTGTYLLTADELIFATKQAWRNAPRCIGRIQW… |
| A0A1Y1II61 | 25-138 | GSVGVFPYPGYVHGKNPTISVEYQDLFHKEFHSSPEVKAARIKEILESIEATGTYSHTFDELQHGARVSWRNAPKCSNRKFWDTIQL… |
| A0A7E4SER2 | 1-88 | None |
| A0A401L2W2 | 48-174 | None |
| Q2U1M4 | 34-177 | None |
| A0A1S3IG29 | 5-98 | None |
| A0A818UGN3 | 83-204 | None |
| A0A1T3NPD6 | 6-128 | None |
| A0A352AP46 | 305-424 | None |
| R7UNF1 | 1-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.